SacC, Recombinant, Bacillus Subtilis, aa25-677, His-Tag (Levanase)

SacC, Recombinant, Bacillus Subtilis, aa25-677, His-Tag (Levanase)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375193.20 20 µg - -

3 - 19 Werktage*

636,00 €
375193.100 100 µg - -

3 - 19 Werktage*

985,00 €
 
Exo-fructosidase that can hydrolyze both levan and inulin, leading to the production of free... mehr
Produktinformationen "SacC, Recombinant, Bacillus Subtilis, aa25-677, His-Tag (Levanase)"
Exo-fructosidase that can hydrolyze both levan and inulin, leading to the production of free fructose. Is also able to hydrolyze sucrose and to a small extent raffinose, but not melezitose, stachylose, cellobiose, maltose, and lactose. Source: Recombinant protein corresponding to aa25-677 from bacillus subtilis Levanase, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~77.2kD, AA Sequence: ADSSYYDEDYRPQYHFTPEANWMNDPNGMVYYAGEYHLFYQYHPYGLQWGPMHWGHAVSKDLVTWEHLPVALYPDEKGTIFSGSAVVDKNNTSGFQTGKEKPLVAIYTQDREGHQVQSIAYSNDKGRTWTKYAGNPVIPNPGKKDFRDPKVFWYEKEKKWVMVLAAGDRILIYTSKNLKQWTYASEFGQDQGSHGGVWECPDLFELPVDGNPNQKKWVMQVSVGNGAVSGGSGMQYFVGDFDGTHFKNENPPNKVLWTDYGRDFYAAVSWSDIPSTDSRRLWLGWMSNWQYANDVPTSPWRSATSIPRELKLKAFTEGVRVVQTPVKELETIRGTSKKWKNLTISPASHNVLAGQSGDAYEINAEFKVSPGSAAEFGFKVRTGENQFTKVGYDRRNAKLFVDRSESGNDTFNPAFNTGKETAPLKPVNGKVKLRIFVDRSSVEVFGNDGKQVITDIILPDRSSKGLELYAANGGVKVKSLTIHPLKKVWGTTPFMSNMTGWTTVNGTWADTIEGKQGRSDGDSFILSSASGSDFTYESDITIKDGNGRGAGALMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVIAEYKTPIDVNKKYHLKTEAEGDRFKIYLDDRLVIDAHDSVFSEGQFGLNVWDATAVFQNVTKES, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: sacC, Levanase, BSU27030, EC=3.2.1.80, Exo-levanase, Exo-beta-D-fructosidase, Beta-D-fructofuranosidase
Hersteller: United States Biological
Hersteller-Nr: 375193

Eigenschaften

Konjugat: No
MW: 77,2
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "SacC, Recombinant, Bacillus Subtilis, aa25-677, His-Tag (Levanase)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen