SAA1, Recombinant, Equine, aa1-110, His-Tag (Serum Amyloid A Protein)

SAA1, Recombinant, Equine, aa1-110, His-Tag (Serum Amyloid A Protein)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375186.20 20 µg - -

3 - 19 Werktage*

511,00 €
375186.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Major acute phase reactant. Apolipoprotein of the HDL complex.||Source:|Recombinant protein... mehr
Produktinformationen "SAA1, Recombinant, Equine, aa1-110, His-Tag (Serum Amyloid A Protein)"
Major acute phase reactant. Apolipoprotein of the HDL complex. Source: Recombinant protein corresponding to aa1-110 from equine SAA1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~16.3kD, AA Sequence: LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: SAA1
Hersteller: United States Biological
Hersteller-Nr: 375186

Eigenschaften

Konjugat: No
MW: 16,3
Format: Highly Purified

Datenbank Information

UniProt ID : P19857 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "SAA1, Recombinant, Equine, aa1-110, His-Tag (Serum Amyloid A Protein)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen