S100A7A, Recombinant, Human, aa2-101, His-Tag (Protein S100-A7A)

S100A7A, Recombinant, Human, aa2-101, His-Tag (Protein S100-A7A)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375183.20 20 µg - -

3 - 19 Werktage*

416,00 €
375183.100 100 µg - -

3 - 19 Werktage*

637,00 €
 
May be involved in epidermal differentiation and inflammation and might therefore be important... mehr
Produktinformationen "S100A7A, Recombinant, Human, aa2-101, His-Tag (Protein S100-A7A)"
May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. Source: Recombinant protein corresponding to aa2-101 from human S100A7A, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~13.2kD, AA Sequence: SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: S100A15, S100A7A, Protein S100-A7A, S100 calcium-binding protein A7A, S100 calcium-binding protein A15, S100 calcium-binding protein A7-like 1
Hersteller: United States Biological
Hersteller-Nr: 375183

Eigenschaften

Konjugat: No
MW: 13,2
Format: Purified

Datenbank Information

UniProt ID : Q86SG5 | Passende Produkte
Gene ID : GeneID 338324 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "S100A7A, Recombinant, Human, aa2-101, His-Tag (Protein S100-A7A)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen