S1, Recombinant, Infectious Bronchitis Virus, aa230-539, GST-Tag (Spike Glycoprotein S1 Subunit)

S1, Recombinant, Infectious Bronchitis Virus, aa230-539, GST-Tag (Spike Glycoprotein S1 Subunit)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375172.20 20 µg - -

3 - 19 Werktage*

511,00 €
375172.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Source:|Recombinant protein corresponding to aa230-539 from infectious bronchitis virus Spike... mehr
Produktinformationen "S1, Recombinant, Infectious Bronchitis Virus, aa230-539, GST-Tag (Spike Glycoprotein S1 Subunit)"
Source:, Recombinant protein corresponding to aa230-539 from infectious bronchitis virus Spike Glycoprotein S1 Subunit, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~62kD, AA Sequence: LACQYNTGNFSDGFYPFTNVSLVKERFVVYRETSVNTTLVLTNFTFTNVSNASPNTGGVNTINIYQTQTAQSGYYNFNFSFLSSFVYKQSDFMYGSYHPKCDFRPETINNGLWFNSLSVSLAYGPLQGGCKQSVFSNRATCCYAYSYNGPRLCKGVYIGELPQYFECGLLVYVIKSDGSRIQTRNEPLVLTHYNYNNITLDRCVEYNIYGRSGQGFIINVTASAANYNYLADGGLAILDTSGAIDIFVVQGEYGPNYYKVNPCEDVNQQFVVSGGGIVGVLTSHNETGSQQLENRFYVKLTNSTRRTRRL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Spike glycoprotein S1 subunit
Hersteller: United States Biological
Hersteller-Nr: 375172

Eigenschaften

Konjugat: No
MW: 62
Format: Highly Purified

Datenbank Information

UniProt ID : D9IAI3 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "S1, Recombinant, Infectious Bronchitis Virus, aa230-539, GST-Tag (Spike Glycoprotein S1 Subunit)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen