RpsU, Recombinant, E. coli, aa2-71, GST-Tag (30S Ribosomal Protein S21)

RpsU, Recombinant, E. coli, aa2-71, GST-Tag (30S Ribosomal Protein S21)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375158.20 20 µg - -

3 - 19 Werktage*

511,00 €
375158.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Source:|Recombinant protein corresponding to aa2-71 from E. coli RpsU, fused to GST-Tag at... mehr
Produktinformationen "RpsU, Recombinant, E. coli, aa2-71, GST-Tag (30S Ribosomal Protein S21)"
Source:, Recombinant protein corresponding to aa2-71 from E. coli RpsU, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.4kD, AA Sequence: PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKLARENARRTRLY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: rpsU, b3065, 30S ribosomal protein S21, Small ribosomal subunit protein bS21
Hersteller: United States Biological
Hersteller-Nr: 375158

Eigenschaften

Konjugat: No
MW: 35,4
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "RpsU, Recombinant, E. coli, aa2-71, GST-Tag (30S Ribosomal Protein S21)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen