RpsO, Recombinant, E. coli, aa2-89, His-Tag (30S Ribosomal Protein S15)

RpsO, Recombinant, E. coli, aa2-89, His-Tag (30S Ribosomal Protein S15)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375155.20 20 µg - -

3 - 19 Werktage*

511,00 €
375155.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate... mehr
Produktinformationen "RpsO, Recombinant, E. coli, aa2-89, His-Tag (30S Ribosomal Protein S15)"
One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assembly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA. In the E. coli 70S ribosome it has been modeled to contact the 23S rRNA of the 50S subunit forming part of bridge B4. In the two 3.5 A resolved ribosome structures there are minor differences between side-chain conformations. Source: Recombinant protein corresponding to aa2-89 from E. coli rpsO, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~14.1kD, AA Sequence: SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: secC, b3165, 30S ribosomal protein S15, Small ribosomal subunit protein uS15
Hersteller: United States Biological
Hersteller-Nr: 375155

Eigenschaften

Konjugat: No
MW: 14,1
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "RpsO, Recombinant, E. coli, aa2-89, His-Tag (30S Ribosomal Protein S15)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen