RpsF, Recombinant, E. coli, aa1-131, GST-Tag (30S Ribosomal Protein S6)

Binds together with S18 to 16S ribosomal RNA. Source: Recombinant protein corresponding to aa1-131 from E. coli rpsF, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.2kD, AA Sequence: MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANETADDAEAGDSEE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.