RpsF, Recombinant, E. coli, aa1-131, GST-Tag (30S Ribosomal Protein S6)

RpsF, Recombinant, E. coli, aa1-131, GST-Tag (30S Ribosomal Protein S6)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375149.20 20 µg - -

3 - 19 Werktage*

511,00 €
375149.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Binds together with S18 to 16S ribosomal RNA.||Source:|Recombinant protein corresponding to... mehr
Produktinformationen "RpsF, Recombinant, E. coli, aa1-131, GST-Tag (30S Ribosomal Protein S6)"
Binds together with S18 to 16S ribosomal RNA. Source: Recombinant protein corresponding to aa1-131 from E. coli rpsF, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.2kD, AA Sequence: MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANETADDAEAGDSEE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: rpsF, b4200
Hersteller: United States Biological
Hersteller-Nr: 375149

Eigenschaften

Konjugat: No
MW: 42,2
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "RpsF, Recombinant, E. coli, aa1-131, GST-Tag (30S Ribosomal Protein S6)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen