RpsC, Recombinant, E. coli, aa2-233, GST-Tag (30S Ribosomal Protein S3)

RpsC, Recombinant, E. coli, aa2-233, GST-Tag (30S Ribosomal Protein S3)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375147.20 20 µg - -

3 - 19 Werktage*

511,00 €
375147.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for... mehr
Produktinformationen "RpsC, Recombinant, E. coli, aa2-233, GST-Tag (30S Ribosomal Protein S3)"
Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation. Plays a role in mRNA unwinding by the ribosome, possibly by forming part of a processivity clamp. Source: Recombinant protein corresponding to aa2-233 from E. coli RpsC, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~52.9kD, AA Sequence: GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRKGRK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: rpsC, b3314, 30S ribosomal protein S3, Small ribosomal subunit protein uS3
Hersteller: United States Biological
Hersteller-Nr: 375147

Eigenschaften

Konjugat: No
MW: 52,9
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "RpsC, Recombinant, E. coli, aa2-233, GST-Tag (30S Ribosomal Protein S3)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen