RpsC, Recombinant, E. coli, aa2-233, GST-Tag (30S Ribosomal Protein S3)

Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation. Plays a role in mRNA unwinding by the ribosome, possibly by forming part of a processivity clamp. Source: Recombinant protein corresponding to aa2-233 from E. coli RpsC, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~52.9kD, AA Sequence: GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRKGRK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.