RPS27, Recombinant, Human, aa1-84, GST-Tag (40S Ribosomal Protein S27)

RPS27, Recombinant, Human, aa1-84, GST-Tag (40S Ribosomal Protein S27)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375142.20 20 µg - -

3 - 19 Werktage*

575,00 €
375142.100 100 µg - -

3 - 19 Werktage*

855,00 €
 
Source:|Recombinant protein corresponding to aa1-84 from human RPS27, fused to GST-Tag at... mehr
Produktinformationen "RPS27, Recombinant, Human, aa1-84, GST-Tag (40S Ribosomal Protein S27)"
Source:, Recombinant protein corresponding to aa1-84 from human RPS27, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.3kD, AA Sequence: PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: MPS1, MPS-1, RPS27, Metallopan-stimulin 1, 40S ribosomal protein S27, Small ribosomal subunit protein eS27
Hersteller: United States Biological
Hersteller-Nr: 375142

Eigenschaften

Konjugat: No
MW: 36,3
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "RPS27, Recombinant, Human, aa1-84, GST-Tag (40S Ribosomal Protein S27)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen