RpmI, Recombinant, E. coli, aa7-65, GST-Tag (50S Ribosomal Protein L35)

RpmI, Recombinant, E. coli, aa7-65, GST-Tag (50S Ribosomal Protein L35)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375128.20 20 µg - -

3 - 19 Werktage*

511,00 €
375128.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Source:|Recombinant protein corresponding to aa7-64 from E. coli 50S Ribosomal Protein L35, fused... mehr
Produktinformationen "RpmI, Recombinant, E. coli, aa7-65, GST-Tag (50S Ribosomal Protein L35)"
Source:, Recombinant protein corresponding to aa7-64 from E. coli 50S Ribosomal Protein L35, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.5kD, AA Sequence: VRGAAKRFKKTGKGGFKHKHANLRHILTKKATKRKRHLRPKAMVSKGDLGLVIACLPY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: rpmI, b1717, Ribosomal protein A, 50S ribosomal protein L35, Large ribosomal subunit protein bL35
Hersteller: United States Biological
Hersteller-Nr: 375128

Eigenschaften

Konjugat: No
MW: 33,5
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "RpmI, Recombinant, E. coli, aa7-65, GST-Tag (50S Ribosomal Protein L35)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen