RpmA, Recombinant, E. coli, aa2-85, His-Tag (50S Ribosomal Protein L27)

RpmA, Recombinant, E. coli, aa2-85, His-Tag (50S Ribosomal Protein L27)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375117.20 20 µg - -

3 - 19 Werktage*

636,00 €
375117.100 100 µg - -

3 - 19 Werktage*

985,00 €
 
Source:|Recombinant protein corresponding to aa2-85 from E. coli 50S Ribosomal Protein L27, fused... mehr
Produktinformationen "RpmA, Recombinant, E. coli, aa2-85, His-Tag (50S Ribosomal Protein L27)"
Source:, Recombinant protein corresponding to aa2-85 from E. coli 50S Ribosomal Protein L27, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~13kD, AA Sequence: AHKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGANVGCGRDHTLFAKADGKVKFEVKGPKNRKFISIEAE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: rpmA, b3185, 50S ribosomal protein L27, Large ribosomal subunit protein bL27
Hersteller: United States Biological
Hersteller-Nr: 375117

Eigenschaften

Konjugat: No
MW: 13
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "RpmA, Recombinant, E. coli, aa2-85, His-Tag (50S Ribosomal Protein L27)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen