RP2, Recombinant, Human, aa1-350, GST-Tag (Protein XRP2)

RP2, Recombinant, Human, aa1-350, GST-Tag (Protein XRP2)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375085.20 20 µg - -

3 - 19 Werktage*

455,00 €
375085.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
Acts as a GTPase-activating protein (GAP) involved in trafficking between the Golgi and the... mehr
Produktinformationen "RP2, Recombinant, Human, aa1-350, GST-Tag (Protein XRP2)"
Acts as a GTPase-activating protein (GAP) involved in trafficking between the Golgi and the ciliary membrane. Involved in localization of proteins, such as NPHP3, to the cilium membrane by inducing hydrolysis of GTP ARL3, leading to the release of UNC119 (or UNC119B). Acts as a GTPase-activating protein (GAP) for tubulin in concert with tubulin-specific chaperone C, but does not enhance tubulin heterodimerization. Acts as guanine nucleotide dissociation inhibitor towards ADP-ribosylation factor-like proteins. Source: Recombinant protein corresponding to aa1-350 from human RP2, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~66.5kD, AA Sequence: GCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: RP2, Protein XRP2
Hersteller: United States Biological
Hersteller-Nr: 375085

Eigenschaften

Konjugat: No
MW: 66,5
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "RP2, Recombinant, Human, aa1-350, GST-Tag (Protein XRP2)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen