Root Allergen Protein, Recombinant, Taraxacum Officinale, aa1-157, His-SUMO-Tag, Myc-Tag

Root Allergen Protein, Recombinant, Taraxacum Officinale, aa1-157, His-SUMO-Tag, Myc-Tag
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
406036.20 20 µg - -

3 - 19 Werktage*

511,00 €
406036.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Source:|Recombinant protein corresponding to aa1-157 from Taraxacum officinale Root allergen... mehr
Produktinformationen "Root Allergen Protein, Recombinant, Taraxacum Officinale, aa1-157, His-SUMO-Tag, Myc-Tag"
Source:, Recombinant protein corresponding to aa1-157 from Taraxacum officinale Root allergen protein, fused to His-SUMO-Tag at N-terminal and fused to Myc-Tag at C terimal, expressed in E. coli. Molecular Weight: ~37.0kD, AA Sequence: MAVAEFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFTSSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGDAKLTDENVSLMKEGLKKTFKAIETYVISHPEAC, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: RAP, Root allergen protein
Hersteller: United States Biological
Hersteller-Nr: 406036

Eigenschaften

Konjugat: No
MW: 37
Format: Purified

Datenbank Information

UniProt ID : O49065 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Root Allergen Protein, Recombinant, Taraxacum Officinale, aa1-157, His-SUMO-Tag, Myc-Tag"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen