RNF125, Recombinant, Human, aa1-232, GST-Tag (E3 Ubiquitin-Protein Ligase RNF125)

RNF125, Recombinant, Human, aa1-232, GST-Tag (E3 Ubiquitin-Protein Ligase RNF125)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375075.20 20 µg - -

3 - 19 Werktage*

455,00 €
375075.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
E3 ubiquitin-protein ligase that acts as a positive regulator of T-cell activation. E3 ligase... mehr
Produktinformationen "RNF125, Recombinant, Human, aa1-232, GST-Tag (E3 Ubiquitin-Protein Ligase RNF125)"
E3 ubiquitin-protein ligase that acts as a positive regulator of T-cell activation. E3 ligase proteins mediate ubiquitination and subsequent proteasomal degradation of target proteins. Source: Recombinant protein corresponding to aa1-232 from human RNF125, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~53.3kD, AA Sequence: GSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCVCPFCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNTT, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: TRAC-1, RING finger protein 125, T-cell RING activation protein 1, E3 ubiquitin-protein ligase RNF125
Hersteller: United States Biological
Hersteller-Nr: 375075

Eigenschaften

Konjugat: No
MW: 53,3
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "RNF125, Recombinant, Human, aa1-232, GST-Tag (E3 Ubiquitin-Protein Ligase RNF125)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen