RNF11, Recombinant, Human, aa2-154, His-Tag (RING Finger Protein 11)

RNF11, Recombinant, Human, aa2-154, His-Tag (RING Finger Protein 11)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375073.20 20 µg - -

3 - 19 Werktage*

416,00 €
375073.100 100 µg - -

3 - 19 Werktage*

637,00 €
 
Essential component of a ubiquitin-editing protein complex, comprising also TNFAIP3, ITCH and... mehr
Produktinformationen "RNF11, Recombinant, Human, aa2-154, His-Tag (RING Finger Protein 11)"
Essential component of a ubiquitin-editing protein complex, comprising also TNFAIP3, ITCH and TAX1BP1, that ensures the transient nature of inflammatory signaling pathways. Promotes the association of TNFAIP3 to RIPK1 after TNF stimulation. TNFAIP3 deubiquitinates 'Lys-63' polyubiquitin chains on RIPK1 and catalyzes the formation of 'Lys-48'-polyubiquitin chains. This leads to RIPK1 proteasomal degradation and consequently termination of the TNF- or LPS-mediated activation of NF-kappa-B. Recruits STAMBP to the E3 ubiquitin-ligase SMURF2 for ubiquitination, leading to its degradation by the 26S proteasome. Source: Recombinant protein corresponding to aa2-154 from human RNF11, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~19.3kD, AA Sequence: GNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: RNF11, CGI-123, RING finger protein 11
Hersteller: United States Biological
Hersteller-Nr: 375073

Eigenschaften

Konjugat: No
MW: 19,3
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "RNF11, Recombinant, Human, aa2-154, His-Tag (RING Finger Protein 11)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen