Riboflavin-binding Protein, Recombinant, Chicken, aa18-225, His-Tag

Riboflavin-binding Protein, Recombinant, Chicken, aa18-225, His-Tag
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375060.20 20 µg - -

3 - 19 Werktage*

511,00 €
375060.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Required for the transport of riboflavin to the developing oocyte.||Source:|Recombinant protein... mehr
Produktinformationen "Riboflavin-binding Protein, Recombinant, Chicken, aa18-225, His-Tag"
Required for the transport of riboflavin to the developing oocyte. Source: Recombinant protein corresponding to aa18-225 from chicken Riboflavin-binding protein, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.9kD, AA Sequence: QQYGCLEGDTHKANPSPEPNMHECTLYSESSCCYANFTEQLAHSPIIKVSNSYWNRCGQLSKSCEDFTKKIECFYRCSPHAARWIDPRYTAAIQSVPLCQSFCDDWYEACKDDSICAHNWLTDWERDESGENHCKSKCVPYSEMYANGTDMCQSMWGESFKVSESSCLCLQMNKKDMVAIKHLLSESSEESSSMSSSEEHACQKKLLK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Hersteller: United States Biological
Hersteller-Nr: 375060

Eigenschaften

Konjugat: No
MW: 27,9
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Riboflavin-binding Protein, Recombinant, Chicken, aa18-225, His-Tag"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen