Respiratory Syncytial Virus A Fusion Glycoprotein F0, Recombinant, Human, aa27-529, His-Tag (F)

Respiratory Syncytial Virus A Fusion Glycoprotein F0, Recombinant, Human, aa27-529, His-Tag (F)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375041.20 20 µg - -

3 - 19 Werktage*

416,00 €
375041.100 100 µg - -

3 - 19 Werktage*

637,00 €
 
During virus entry, induces fusion of viral and cellular membranes leading to delivery of the... mehr
Produktinformationen "Respiratory Syncytial Virus A Fusion Glycoprotein F0, Recombinant, Human, aa27-529, His-Tag (F)"
During virus entry, induces fusion of viral and cellular membranes leading to delivery of the nucleocapsid into the cytoplasm. The fusogenic activity is inactive untill entry into host cell endosome, where a furin-like protease cleaves off a small peptide between F1 and F2. Interacts directly with heparan sulfate and may participates in virus attachment. Furthermore, the F2 subunit was identifed as the major determinant of RSV host cell specificity. Later in infection, proteins F expressed at the plasma membrane of infected cells can mediate fusion with adjacent cells to form syncytia, a cytopathic effect that could lead to tissue necrosis. The fusion protein is also able to trigger p53-dependent apoptosis. Source: Recombinant protein corresponding to aa27-529 from human Respiratory Syncytial Virus A Fusion Glycoprotein F0, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~57.9kD, AA Sequence: NITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITT, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: F
Hersteller: United States Biological
Hersteller-Nr: 375041

Eigenschaften

Konjugat: No
MW: 57,9
Format: Highly Purified

Datenbank Information

UniProt ID : P03420 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Respiratory Syncytial Virus A Fusion Glycoprotein F0, Recombinant, Human, aa27-529, His-Tag (F)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen