RepD, Recombinant, Staphylococcus Aureus, aa1-311, His-SUMO-Tag (Replication Initiation Protein)

RepD, Recombinant, Staphylococcus Aureus, aa1-311, His-SUMO-Tag (Replication Initiation Protein)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375038.20 20 µg - -

3 - 19 Werktage*

511,00 €
375038.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
This protein is probably a specific topoisomerase involved in initiating replication. This... mehr
Produktinformationen "RepD, Recombinant, Staphylococcus Aureus, aa1-311, His-SUMO-Tag (Replication Initiation Protein)"
This protein is probably a specific topoisomerase involved in initiating replication. This protein is specifically required and may be rate-limiting for replication of the plasmid in vivo. Source: Recombinant protein corresponding to aa1-311 from staphylococcus aureus Replication Initiation Protein, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~53.5kD, AA Sequence: MSTENHSNYLQNKDLDNFSKTGYSNSRLSGNFFTTPQPELSFDAMTIVGNLNKTNAKKLSDFMSTEPQIRLWDILQTKFKAKALQEKVYIEYDKVKADSWDRRNMRVEFNPNKLTHEEMLWLKQNIIDYMEDDGFTRLDLAFDFEDDLSDYYAMTDKAVKKTIFYGRNGKPETKYFGVRDSDRFIRIYNKKQERKDNADVEVMSEHLWRVEIELKRDMVDYWNDCFDDLHILKPDWTTPEKVKEQAMVYLLLNEEGTWGKLERHAKYKYKQLIKEISPIDLTELMKSTLKENEKQLQKQIDFWQREFRFWK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: repD, Replication initiation protein
Hersteller: United States Biological
Hersteller-Nr: 375038

Eigenschaften

Konjugat: No
MW: 53,5
Format: Highly Purified

Datenbank Information

UniProt ID : P03065 | Passende Produkte
Gene ID : GeneID 3355242 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "RepD, Recombinant, Staphylococcus Aureus, aa1-311, His-SUMO-Tag (Replication Initiation Protein)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen