Reg3g, Recombinant, Mouse, aa27-174, His-Tag (Regenerating Islet-derived Protein 3-gamma)

Reg3g, Recombinant, Mouse, aa27-174, His-Tag (Regenerating Islet-derived Protein 3-gamma)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375027.20 20 µg - -

3 - 19 Werktage*

455,00 €
375027.100 100 µg - -

3 - 19 Werktage*

713,00 €
Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates... mehr
Produktinformationen "Reg3g, Recombinant, Mouse, aa27-174, His-Tag (Regenerating Islet-derived Protein 3-gamma)"
Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury. Source: Recombinant protein corresponding to aa27-174 from mouse Reg3g, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~20.3kD, AA Sequence: EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Pap3, Reg3g
Hersteller: United States Biological
Hersteller-Nr: 375027


Konjugat: No
MW: 20,3
Format: Highly Purified

Datenbank Information

UniProt ID : O09049 | Passende Produkte
Gene ID : GeneID 19695 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Reg3g, Recombinant, Mouse, aa27-174, His-Tag (Regenerating Islet-derived Protein 3-gamma)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen