Reg3a, Recombinant, Rat, aa26-174, His-Tag (Regenerating Islet-derived Protein 3-alpha)

Reg3a, Recombinant, Rat, aa26-174, His-Tag (Regenerating Islet-derived Protein 3-alpha)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375024.20 20 µg - -

3 - 19 Werktage*

455,00 €
375024.200 200 µg - -

3 - 19 Werktage*

1.007,00 €
 
Bactericidal C-type lectin. Regulates keratinocyte proliferation and differentiation after skin... mehr
Produktinformationen "Reg3a, Recombinant, Rat, aa26-174, His-Tag (Regenerating Islet-derived Protein 3-alpha)"
Bactericidal C-type lectin. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway. Source: Recombinant protein corresponding to aa26-174 from rat Reg3a, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~20.5kD, AA Sequence: EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Pap2, Reg3a
Hersteller: United States Biological
Hersteller-Nr: 375024

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Rat
MW: 20.5 kD
Reinheit: ~90% (SDS-PAGE)

Datenbank Information

UniProt ID : P35231 | Passende Produkte
Gene ID : GeneID 171162 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Reg3a, Recombinant, Rat, aa26-174, His-Tag (Regenerating Islet-derived Protein 3-alpha)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen