RecO, Recombinant, E. coli, aa1-242, His-SUMO-Tag (DNA Repair Protein RecO)

RecO, Recombinant, E. coli, aa1-242, His-SUMO-Tag (DNA Repair Protein RecO)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375019.20 20 µg - -

3 - 19 Werktage*

511,00 €
375019.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Involved in DNA repair and RecF pathway recombination.||Source:|Recombinant protein corresponding... mehr
Produktinformationen "RecO, Recombinant, E. coli, aa1-242, His-SUMO-Tag (DNA Repair Protein RecO)"
Involved in DNA repair and RecF pathway recombination. Source: Recombinant protein corresponding to aa1-242 from E. coli RecO, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.4kD, AA Sequence: MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFMPKRTVKTHYE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: recO, b2565, Recombination protein O, DNA repair protein RecO
Hersteller: United States Biological
Hersteller-Nr: 375019

Eigenschaften

Konjugat: No
MW: 43,4
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "RecO, Recombinant, E. coli, aa1-242, His-SUMO-Tag (DNA Repair Protein RecO)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen