RecO, Recombinant, E. coli, aa1-242, His-SUMO-Tag (DNA Repair Protein RecO)

Involved in DNA repair and RecF pathway recombination. Source: Recombinant protein corresponding to aa1-242 from E. coli RecO, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.4kD, AA Sequence: MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFMPKRTVKTHYE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.