RBX1, Recombinant, Human, aa1-108, GST-Tag (E3 Ubiquitin-Protein Ligase RBX1)

RBX1, Recombinant, Human, aa1-108, GST-Tag (E3 Ubiquitin-Protein Ligase RBX1)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375011.20 20 µg - -

3 - 19 Werktage*

455,00 €
375011.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
E3 ubiquitin ligase component of multiple cullin-RING-based E3 ubiquitin-protein ligase (CRLs)... mehr
Produktinformationen "RBX1, Recombinant, Human, aa1-108, GST-Tag (E3 Ubiquitin-Protein Ligase RBX1)"
E3 ubiquitin ligase component of multiple cullin-RING-based E3 ubiquitin-protein ligase (CRLs) complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair. CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets. The functional specificity of the E3 ubiquitin-protein ligase complexes depends on the variable substrate recognition components. As a component of the CSA complex promotes the ubiquitination of ERCC6 resulting in proteasomal degradation. Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme, like CDC34, to the complex and brings it into close proximity to the substrate. Probably also stimulates CDC34 autoubiquitination. May be required for histone H3 and histone H4 ubiquitination in response to ultraviolet and for subsequent DNA repair. Promotes the neddylation of CUL1, CUL2, CUL4 and CUL4 via its interaction with UBE2M. Involved in the ubiquitination of KEAP1, ENC1 and KLHL41. In concert with ATF2 and CUL3, promotes degradation of KAT5 thereby attenuating its ability to acetylate and activate ATM. Source: Recombinant protein corresponding to aa1-108 from human RBX1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.3kD, AA Sequence: MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: RBX1, RNF75
Hersteller: United States Biological
Hersteller-Nr: 375011

Eigenschaften

Konjugat: No
MW: 39,3
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "RBX1, Recombinant, Human, aa1-108, GST-Tag (E3 Ubiquitin-Protein Ligase RBX1)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen