RAVER2, Recombinant, Human, aa1-140, His-Tag (Ribonucleoprotein PTB-binding 2)

May bind single-stranded nucleic acids. Curated. Source: Recombinant protein corresponding to aa1-140 from human Ribonucleoprotein PTB-binding 2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.0kD, AA Sequence: MAAAAGDGGGEGGAGLGSAAGLGPGPGLRGQGPSAEAHEGAPDPMPAALHPEEVAARLQRMQRELSNRRKILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPT, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.