RAVER2, Recombinant, Human, aa1-140, His-Tag (Ribonucleoprotein PTB-binding 2)

RAVER2, Recombinant, Human, aa1-140, His-Tag (Ribonucleoprotein PTB-binding 2)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374995.20 20 µg - -

3 - 19 Werktage*

416,00 €
374995.100 100 µg - -

3 - 19 Werktage*

637,00 €
 
May bind single-stranded nucleic acids. Curated.||Source:|Recombinant protein corresponding to... mehr
Produktinformationen "RAVER2, Recombinant, Human, aa1-140, His-Tag (Ribonucleoprotein PTB-binding 2)"
May bind single-stranded nucleic acids. Curated. Source: Recombinant protein corresponding to aa1-140 from human Ribonucleoprotein PTB-binding 2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.0kD, AA Sequence: MAAAAGDGGGEGGAGLGSAAGLGPGPGLRGQGPSAEAHEGAPDPMPAALHPEEVAARLQRMQRELSNRRKILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPT, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: RAVER2, KIAA1579, Protein raver-2, Ribonucleoprotein PTB-binding 2
Hersteller: United States Biological
Hersteller-Nr: 374995

Eigenschaften

Konjugat: No
MW: 17
Format: Highly Purified

Datenbank Information

UniProt ID : Q9HCJ3 | Passende Produkte
Gene ID : GeneID 55225 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "RAVER2, Recombinant, Human, aa1-140, His-Tag (Ribonucleoprotein PTB-binding 2)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen