Puromycin N-acetyltransferase, Recombinant, Streptomyces Alboniger, aa1-199, His-Tag (Pac)

Puromycin N-acetyltransferase, Recombinant, Streptomyces Alboniger, aa1-199, His-Tag (Pac)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
406028.20 20 µg - -

3 - 19 Werktage*

511,00 €
406028.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Detoxification of puromycin.||Source:|Recombinant protein corresponding to aa1-199 from... mehr
Produktinformationen "Puromycin N-acetyltransferase, Recombinant, Streptomyces Alboniger, aa1-199, His-Tag (Pac)"
Detoxification of puromycin. Source: Recombinant protein corresponding to aa1-199 from streptomyces alboniger Puromycin N-acetyltransferase, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~25.5kD, AA Sequence: MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIERVTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLAAQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETSAPRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: pac, EC=2.3.-.-, Puromycin N-acetyltransferase
Hersteller: United States Biological
Hersteller-Nr: 406028

Eigenschaften

Konjugat: No
MW: 25,5
Format: Purified

Datenbank Information

KEGG ID : K12632 | Passende Produkte
UniProt ID : P13249 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Puromycin N-acetyltransferase, Recombinant, Streptomyces Alboniger, aa1-199, His-Tag (Pac)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen