PTH, Recombinant, E. coli, aa1-194, His-Tag (Peptidyl-tRNA Hydrolase)

PTH, Recombinant, E. coli, aa1-194, His-Tag (Peptidyl-tRNA Hydrolase)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374922.20 20 µg - -

3 - 19 Werktage*

511,00 €
374922.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during... mehr
Produktinformationen "PTH, Recombinant, E. coli, aa1-194, His-Tag (Peptidyl-tRNA Hydrolase)"
The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis. Involved in lambda inhibition of host protein synthesis. PTH activity may, directly or indirectly, be the target for lambda bar RNA leading to rap cell death. Source: Recombinant protein corresponding to aa1-194 from E. coli Peptidyl-tRNA Hydrolase, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~25.1kD, AA Sequence: MTIKLIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVRLLVPTTFMNLSGKAVAAMASFFRINPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRIGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAARCTEMWFTDGLTKATNRLHAFKAQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: PTH, b1204, Peptidyl-tRNA hydrolase
Hersteller: United States Biological
Hersteller-Nr: 374922

Eigenschaften

Konjugat: No
MW: 25,1
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PTH, Recombinant, E. coli, aa1-194, His-Tag (Peptidyl-tRNA Hydrolase)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen