Pseudolysin, Recombinant, Pseudomonas Aeruginosa, aa198-498, His-SUMO-Tag (LasB)

Pseudolysin, Recombinant, Pseudomonas Aeruginosa, aa198-498, His-SUMO-Tag (LasB)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374903.20 20 µg - -

3 - 19 Werktage*

511,00 €
374903.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Cleaves host elastin, collagen, IgG, and several complement components as well as endogenous... mehr
Produktinformationen "Pseudolysin, Recombinant, Pseudomonas Aeruginosa, aa198-498, His-SUMO-Tag (LasB)"
Cleaves host elastin, collagen, IgG, and several complement components as well as endogenous pro-aminopeptidase (PubMed:11533066). Autocatalyses processing of its pro-peptide (PubMed:9642203, PubMed:1744034). Processes the pro-peptide of pro-chitin-binding protein (cbpD) (PubMed:9642203). Involved in the pathogenesis of P.aeruginosa infections. Source: Recombinant protein corresponding to aa198-498 from pseudomonas aeruginosa Pseudolysin, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~49.1kD, AA Sequence: AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSAL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: lasB, PA3724, EC=3.4.24.26
Hersteller: United States Biological
Hersteller-Nr: 374903

Eigenschaften

Konjugat: No
MW: 49,1
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Pseudolysin, Recombinant, Pseudomonas Aeruginosa, aa198-498, His-SUMO-Tag (LasB)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen