PSCA, Recombinant, Human, aa21-95, His-Tag (Prostate Stem Cell Antigen)

PSCA, Recombinant, Human, aa21-95, His-Tag (Prostate Stem Cell Antigen)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374901.20 20 µg - -

3 - 19 Werktage*

416,00 €
374901.100 100 µg - -

3 - 19 Werktage*

637,00 €
 
May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition... mehr
Produktinformationen "PSCA, Recombinant, Human, aa21-95, His-Tag (Prostate Stem Cell Antigen)"
May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro. Source: Recombinant protein corresponding to aa21-95 from human PSCA, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~10.2kD, AA Sequence: LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: PSCA, Prostate stem cell antigen
Hersteller: United States Biological
Hersteller-Nr: 374901

Eigenschaften

Konjugat: No
MW: 10,2
Format: Highly Purified

Datenbank Information

UniProt ID : O43653 | Passende Produkte
Gene ID : GeneID 8000 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PSCA, Recombinant, Human, aa21-95, His-Tag (Prostate Stem Cell Antigen)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen