PSCA, Recombinant, Human, aa21-95, His-Tag (Prostate Stem Cell Antigen)

May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro. Source: Recombinant protein corresponding to aa21-95 from human PSCA, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~10.2kD, AA Sequence: LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.