PSAP, Recombinant, Human, aa311-391, His-Tag (Prosaposin)

PSAP, Recombinant, Human, aa311-391, His-Tag (Prosaposin)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374897.20 20 µg - -

3 - 19 Werktage*

416,00 €
374897.100 100 µg - -

3 - 19 Werktage*

637,00 €
 
Saposin-A and saposin-C stimulate the hydrolysis of glucosylceramide by beta-glucosylceramidase... mehr
Produktinformationen "PSAP, Recombinant, Human, aa311-391, His-Tag (Prosaposin)"
Saposin-A and saposin-C stimulate the hydrolysis of glucosylceramide by beta-glucosylceramidase and galactosylceramide by beta-galactosylceramidase. Saposin-C apparently acts by combining with the enzyme and acidic lipid to form an activated complex, rather than by solubilizing the substrate. Saposin-B stimulates the hydrolysis of galacto-cerebroside sulfate by arylsulfatase A, GM1 gangliosides by beta-galactosidase and globotriaosylceramide by alpha-galactosidase A. Saposin-B forms a solubilizing complex with the substrates of the sphingolipid hydrolases. Saposin-D is a specific sphingomyelin phosphodiesterase activator. Prosaposin: Behaves as a myelinotrophic and neurotrophic factor, these effects are mediated by its G-protein-coupled receptors, GPR37 and GPR37L1, undergoing ligand-mediated internalization followed by ERK phosphorylation signaling. Saposins are specific low-molecular mass non-enzymic proteins, they participate in the lysosomal degradation of sphingolipids, which takes place by the sequential action of specific hydrolases. Source: Recombinant protein corresponding to aa311-391 from human PSAP, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.1kD, AA Sequence: SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGT, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: GLBA, PSAP
Hersteller: United States Biological
Hersteller-Nr: 374897

Eigenschaften

Konjugat: No
MW: 11,1
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PSAP, Recombinant, Human, aa311-391, His-Tag (Prosaposin)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen