Protein X, Recombinant, Woodchuck Hepatitis B Virus, aa1-141, His-Tag (X)

Protein X, Recombinant, Woodchuck Hepatitis B Virus, aa1-141, His-Tag (X)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374887.20 20 µg - -

3 - 19 Werktage*

511,00 €
374887.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Multifunctional protein that may modulate protein degradation pathways, apoptosis, transcription,... mehr
Produktinformationen "Protein X, Recombinant, Woodchuck Hepatitis B Virus, aa1-141, His-Tag (X)"
Multifunctional protein that may modulate protein degradation pathways, apoptosis, transcription, signal transduction, cell cycle progress, and genetic stability by directly or indirectly interacting with hosts factors. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellular carcinoma). Most of cytosolic activities involve modulation of cytosolic calcium. Effect on apoptosis is controversial depending on the cell types in which the studies have been conducted. Source: Recombinant protein corresponding to aa1-141 from woodchuck hepatitis B virus Protein X, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~19.2kD, AA Sequence: MAARLCCHLDSARDVLLLRPFGPQSSGPSFPRPAAGSAASSASSPSPSDESDLPLGRLPACFASASGPCCLVFTCADLRTMDSTVNFVSWHANRQLGMPSKDLWTPYIKDQLLTKWEEGSIDPRLSIFVLGGCRHKCMRLL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: pX, HBx, Peptide X, Protein X
Hersteller: United States Biological
Hersteller-Nr: 374887

Eigenschaften

Konjugat: No
MW: 19,2
Format: Highly Purified

Datenbank Information

UniProt ID : P17401 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Protein X, Recombinant, Woodchuck Hepatitis B Virus, aa1-141, His-Tag (X)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen