Protein X, Recombinant, Hepatitis B Virus genotype D, aa1-154, His-SUMO-Tag (X)

Protein X, Recombinant, Hepatitis B Virus genotype D, aa1-154, His-SUMO-Tag (X)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374885.20 20 µg - -

3 - 19 Werktage*

511,00 €
374885.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Multifunctional protein that may modulate protein degradation pathways, apoptosis, transcription,... mehr
Produktinformationen "Protein X, Recombinant, Hepatitis B Virus genotype D, aa1-154, His-SUMO-Tag (X)"
Multifunctional protein that may modulate protein degradation pathways, apoptosis, transcription, signal transduction, cell cycle progress, and genetic stability by directly or indirectly interacting with hosts factors. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellular carcinoma). Most of cytosolic activities involve modulation of cytosolic calcium. The effect on apoptosis is controversial depending on the cell types in which the studies have been conducted. By binding to human DDB1, may affect cell viability and stimulate genome replication. May induce apoptosis by localizing in mitochondria and causing loss of mitochondrial membrane potential. May also modulate apoptosis by binding human CFLAR, a key regulator of the death-inducing signaling complex (DISC). Moderately stimulates transcription of many different viral and cellular transcription elements. Promoters and enhancers stimulated by HBx contain DNA binding sites for NF-kappa-B, AP-1, AP-2, c-EBP, ATF/CREB, or the calcium-activated factor NF-AT. May bind bZIP transcription factors like CREB1 (By similarity). Source: Recombinant protein corresponding to aa1-154 from hepatitis B virus genotype D Protein X, fused to His-SUMO-Tag at N-terminal. expressed in E. coli. Molecular Weight: ~32.7kD, AA Sequence: MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: pX, HBx, Peptide X, Protein X
Hersteller: United States Biological
Hersteller-Nr: 374885

Eigenschaften

Konjugat: No
MW: 32,7
Format: Highly Purified

Datenbank Information

UniProt ID : O93195 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Protein X, Recombinant, Hepatitis B Virus genotype D, aa1-154, His-SUMO-Tag (X)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen