Protein Vpx, Recombinant, Simian immunodeficiency virus, aa1-112, His-SUMO-Tag (Vpx)

Protein Vpx, Recombinant, Simian immunodeficiency virus, aa1-112, His-SUMO-Tag (Vpx)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374883.20 20 µg - -

3 - 19 Werktage*

636,00 €
374883.100 100 µg - -

3 - 19 Werktage*

985,00 €
 
Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is... mehr
Produktinformationen "Protein Vpx, Recombinant, Simian immunodeficiency virus, aa1-112, His-SUMO-Tag (Vpx)"
Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription. Source: Recombinant protein corresponding to aa1-112 from simian immunodeficiency virus Protein Vpx, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~28.9kD, AA Sequence: MSDPRERIPPGNSGEETIGEAFDWLDRTVEEINRAAVNHLPRELIFQVWRRSWEYWHDEMGMSVSYTKYRYLCLIQKAMFMHCKKGCRCLGGEHGAGGWRPGPPPPPPPGLA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: vpx, Protein Vpx, X ORF protein, Viral protein X
Hersteller: United States Biological
Hersteller-Nr: 374883

Eigenschaften

Konjugat: No
MW: 28,9
Format: Purified

Datenbank Information

UniProt ID : P19508 | Passende Produkte

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Protein Vpx, Recombinant, Simian immunodeficiency virus, aa1-112, His-SUMO-Tag (Vpx)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen