Prolactin-inducible Protein Homolog, Recombinant, Rat, aa27-146, His-Tag (PIP)

Source:, Recombinant protein corresponding to aa27-146 from rat Prolactin-inducible Protein Homolog, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.7kD, AA Sequence: QDNETIPQPLLFQLNVPSTPDENQEVDMSLTLQTQYKECLVVKAYLISNTPVDGGFNYIQTRCICNDHPTTLYWTFVVTQTLTFRIMVDIVKDKGICPNNVAVVPISGNRYFTDRTVYVN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.