Prolactin-inducible Protein Homolog, Recombinant, Rat, aa27-146, His-Tag (PIP)

Prolactin-inducible Protein Homolog, Recombinant, Rat, aa27-146, His-Tag (PIP)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374868.20 20 µg - -

3 - 19 Werktage*

455,00 €
374868.100 100 µg - -

3 - 19 Werktage*

711,00 €
 
Source:|Recombinant protein corresponding to aa27-146 from rat Prolactin-inducible Protein... mehr
Produktinformationen "Prolactin-inducible Protein Homolog, Recombinant, Rat, aa27-146, His-Tag (PIP)"
Source:, Recombinant protein corresponding to aa27-146 from rat Prolactin-inducible Protein Homolog, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.7kD, AA Sequence: QDNETIPQPLLFQLNVPSTPDENQEVDMSLTLQTQYKECLVVKAYLISNTPVDGGFNYIQTRCICNDHPTTLYWTFVVTQTLTFRIMVDIVKDKGICPNNVAVVPISGNRYFTDRTVYVN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Pip, Prolactin-induced protein, Prolactin-inducible protein homolog
Hersteller: United States Biological
Hersteller-Nr: 374868

Eigenschaften

Konjugat: No
MW: 15,7
Format: Highly Purified

Datenbank Information

UniProt ID : O70417 | Passende Produkte
Gene ID : GeneID 64673 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Prolactin-inducible Protein Homolog, Recombinant, Rat, aa27-146, His-Tag (PIP)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen