PPP1R1B, Recombinant, Human, aa1-168, GST-Tag (Protein Phosphatase 1 Regulatory Subunit 1B)

Inhibitor of protein-phosphatase 1. Source: Recombinant protein corresponding to aa1-168 from human PPP1R1B, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~45.7kD, AA Sequence: MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.