PPP1R1B, Recombinant, Human, aa1-168, GST-Tag (Protein Phosphatase 1 Regulatory Subunit 1B)

PPP1R1B, Recombinant, Human, aa1-168, GST-Tag (Protein Phosphatase 1 Regulatory Subunit 1B)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374822.20 20 µg - -

3 - 19 Werktage*

455,00 €
374822.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
Inhibitor of protein-phosphatase 1.||Source:|Recombinant protein corresponding to aa1-168 from... mehr
Produktinformationen "PPP1R1B, Recombinant, Human, aa1-168, GST-Tag (Protein Phosphatase 1 Regulatory Subunit 1B)"
Inhibitor of protein-phosphatase 1. Source: Recombinant protein corresponding to aa1-168 from human PPP1R1B, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~45.7kD, AA Sequence: MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: PPP1R1B, DARPP32, DARPP-32, Protein phosphatase 1 regulatory subunit 1B, Dopamine- and cAMP-regulated neuronal phosphoprotein
Hersteller: United States Biological
Hersteller-Nr: 374822

Eigenschaften

Konjugat: No
MW: 45,7
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PPP1R1B, Recombinant, Human, aa1-168, GST-Tag (Protein Phosphatase 1 Regulatory Subunit 1B)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen