PPDK, Recombinant, Entamoeba Histolytica, aa1-342, His-SUMO-Tag (Pyruvate, Phosphate Dikinase)

PPDK, Recombinant, Entamoeba Histolytica, aa1-342, His-SUMO-Tag (Pyruvate, Phosphate Dikinase)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374812.20 20 µg - -

3 - 19 Werktage*

511,00 €
374812.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Catalyzes the reversible phosphorylation of pyruvate and phosphate. In E.histolytica and... mehr
Produktinformationen "PPDK, Recombinant, Entamoeba Histolytica, aa1-342, His-SUMO-Tag (Pyruvate, Phosphate Dikinase)"
Catalyzes the reversible phosphorylation of pyruvate and phosphate. In E.histolytica and C.symbiosus, PPDK functions in the direction of ATP synthesis. Source: Recombinant protein corresponding to aa1-342 from entamoeba histolytica PPDK, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~54.4kD, AA Sequence: MQRVYAFEDGDGTNKKLLGGKGAGLCTMTKIGLPVPQGFVITTEMCKQFIANGNKMPEGLMEEVKKEYQLVEKKSGKVFGGEENPLLVSVRSGAAMSMPGMMDTILNLGLNDKTVVALAKLTNNERFAYDSYRRFVSLFGKIALNACDEVYDKTLENKKVEKGVKLDTELDANDMKELAQVFIKKTEEFTKQPFPVDPYAQLEFAICAVFRSWMGKRAVDYRREFKITPEQADGTAVSVVSMVYGNMGNDSATGVCFTRDPGTGENMFFGEYLKNAQGEDVVAGIRTPQIISKMAEDRDLPGCYEQLLDIRKKLEGYFHEVQDFEFTIERKKLYMLQTRNGK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: PPDK, EC=2.7.9.1, Pyruvate, phosphate dikinase, Pyruvate, orthophosphate dikinase
Hersteller: United States Biological
Hersteller-Nr: 374812

Eigenschaften

Konjugat: No
MW: 54,4
Format: Purified

Datenbank Information

UniProt ID : P37213 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PPDK, Recombinant, Entamoeba Histolytica, aa1-342, His-SUMO-Tag (Pyruvate, Phosphate Dikinase)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen