PPAN, Recombinant, Human, aa1-473, His-Tag (Suppressor of SWI4 1 Homolog)

PPAN, Recombinant, Human, aa1-473, His-Tag (Suppressor of SWI4 1 Homolog)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374808.20 20 µg - -

3 - 19 Werktage*

416,00 €
374808.100 100 µg - -

3 - 19 Werktage*

637,00 €
 
May have a role in cell growth.||Source:|Recombinant protein corresponding to aa1-473 from human... mehr
Produktinformationen "PPAN, Recombinant, Human, aa1-473, His-Tag (Suppressor of SWI4 1 Homolog)"
May have a role in cell growth. Source: Recombinant protein corresponding to aa1-473 from human PPAN, fused to His-Tag at N-terminal expressed in Yeast. Molecular Weight: ~55.2kD, AA Sequence: MGQSGRSRHQKRARAQAQLRNLEAYAANPHSFVFTRGCTGRNIRQLSLDVRRVMEPLTASRLQVRKKNSLKDCVAVAGPLGVTHFLILSKTETNVYFKLMRLPGGPTLTFQVKKYSLVRDVVSSLRRHRMHEQQFAHPPLLVLNSFGPHGMHVKLMATMFQNLFPSINVHKVNLNTIKRCLLIDYNPDSQELDFRHYSIKVVPVGASRGMKKLLQEKFPNMSRLQDISELLATGAGLSESEAEPDGDHNITELPQAVAGRGNMRAQQSAVRLTEIGPRMTLQLIKVQEGVGEGKVMFHSFVSKTEEELQAILEAKEKKLRLKAQRQAQQAQNVQRKQEQREAHRKKSLEGMKKARVGGSDEEASGIPSRTASLELGEDDDEQEDDDIEYFCQAVGEAPSEDLFPEAKQKRLAKSPGRKRKRWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGGRGRGRGRPGKRVA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: PPAN, BXDC3, Ssf-1, Peter Pan homolog, Suppressor of SWI4 1 homolog, Brix domain-containing protein 3
Hersteller: United States Biological
Hersteller-Nr: 374808

Eigenschaften

Konjugat: No
MW: 55,2
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PPAN, Recombinant, Human, aa1-473, His-Tag (Suppressor of SWI4 1 Homolog)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen