Porin P, Recombinant, Pseudomonas aeruginosa, aa30-440, His-SUMO-Tag (OprP, Outer Membrane Protein D

Porin P, Recombinant, Pseudomonas aeruginosa, aa30-440, His-SUMO-Tag (OprP, Outer Membrane Protein D
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374802.20 20 µg - -

3 - 19 Werktage*

511,00 €
374802.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Anion specific, the binding site has higher affinity for phosphate than chloride ions. Porin O... mehr
Produktinformationen "Porin P, Recombinant, Pseudomonas aeruginosa, aa30-440, His-SUMO-Tag (OprP, Outer Membrane Protein D"
Anion specific, the binding site has higher affinity for phosphate than chloride ions. Porin O has a higher affinity for polyphosphates (tripolyphosphate and pyrophosphate) while porin P has a higher affinity for orthophosphate. Source: Recombinant protein corresponding to aa30-440 from pseudomonas aeruginosa oprP, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~61.2kD, AA Sequence: GTVTTDGADIVIKTKGGLEVATTDKEFSFKLGGRLQADYGRFDGYYTNNGNTADAAYFRRAYLEFGGTAYRDWKYQINYDLSRNVGNDSAGYFDEASVTYTGFNPVNLKFGRFYTDFGLEKATSSKWVTALERNLTYDIADWVNDNVGTGIQASSVVGGMAFLSGSVFSENNNDTDGDSVKRYNLRGVFAPLHEPGNVVHLGLQYAYRDLEDSAVDTRIRPRMGMRGVSTNGGNDAGSNGNRGLFGGSSAVEGLWKDDSVWGLEGAWALGAFSAQAEYLRRTVKAERDREDLKASGYYAQLAYTLTGEPRLYKLDGAKFDTIKPENKEIGAWELFYRYDSIKVEDDNIVVDSATREVGDAKGKTHTLGVNWYANEAVKVSANYVKAKTDKISNANGDDSGDGLVMRLQYVF, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: oprP, PA3279, Porin P, Outer membrane protein D1
Hersteller: United States Biological
Hersteller-Nr: 374802

Eigenschaften

Konjugat: No
MW: 61,2
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Porin P, Recombinant, Pseudomonas aeruginosa, aa30-440, His-SUMO-Tag (OprP, Outer Membrane Protein D"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen