Polymerase Acidic Protein, Recombinant, Influenza A virus, aa124-247, His-Tag (PA)

Polymerase Acidic Protein, Recombinant, Influenza A virus, aa124-247, His-Tag (PA)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
406022.20 20 µg - -

3 - 19 Werktage*

511,00 €
406022.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Plays an essential role in viral RNA transcription and replication by forming the heterotrimeric... mehr
Produktinformationen "Polymerase Acidic Protein, Recombinant, Influenza A virus, aa124-247, His-Tag (PA)"
Plays an essential role in viral RNA transcription and replication by forming the heterotrimeric polymerase complex together with PB1 and PB2 subunits. The complex transcribes viral mRNAs by using a unique mechanism called cap-snatching. It consists in the hijacking and cleavage of host capped pre-mRNAs. These short capped RNAs are then used as primers for viral mRNAs. The PB2 subunit is responsible for the binding of the 5' cap of cellular pre-mRNAs which are subsequently cleaved after 10-13 nucleotides by the PA subunit that carries the endonuclease activity. Source: Recombinant protein corresponding to aa124-247 from Influenza A virus Polymerase acidic protein, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~18.6kD, AA Sequence: RREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERGEETIEERFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGYIEGKLS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Polymerase acidic protein, RNA-directed RNA polymerase subunit P2
Hersteller: United States Biological
Hersteller-Nr: 406022

Eigenschaften

Konjugat: No
MW: 18,6
Format: Purified

Datenbank Information

UniProt ID : Q9IQ47 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Polymerase Acidic Protein, Recombinant, Influenza A virus, aa124-247, His-Tag (PA)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen