PODXL, Recombinant, Human, aa32-458, His-Tag (Podocalyxin Protein)

PODXL, Recombinant, Human, aa32-458, His-Tag (Podocalyxin Protein)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374777.20 20 µg - -

3 - 19 Werktage*

531,00 €
374777.100 100 µg - -

3 - 19 Werktage*

773,00 €
 
Involved in the regulation of both adhesion and cell morphology and cancer progression. Function... mehr
Produktinformationen "PODXL, Recombinant, Human, aa32-458, His-Tag (Podocalyxin Protein)"
Involved in the regulation of both adhesion and cell morphology and cancer progression. Function as an anti-adhesive molecule that maintains an open filtration pathway between neighboring foot processes in the podocyte by charge repulsion. Acts as a pro-adhesive molecule, enhancing the adherence of cells to immobilized ligands, increasing the rate of migration and cell-cell contacts in an integrin-dependent manner. Induces the formation of apical actin-dependent microvilli. Involved in the formation of a preapical plasma membrane subdomain to set up inital epithelial polarization and the apical lumen formation during renal tubulogenesis. Plays a role in cancer development and aggressiveness by inducing cell migration and invasion through its interaction with the actin-binding protein EZR. Affects EZR-dependent signaling events, leading to increased activities of the MAPK and PI3K pathways in cancer cells. Source: Recombinant protein corresponding to aa32-458 from human PODXL, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~46.2kD, AA Sequence: QNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRF, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: PC, PCLP, Gp200, PODXL, PCLP-1, Podocalyxin, GCTM-2 antigen, Podocalyxin-like protein 1
Hersteller: United States Biological
Hersteller-Nr: 374777

Eigenschaften

Konjugat: No
MW: 46,2
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PODXL, Recombinant, Human, aa32-458, His-Tag (Podocalyxin Protein)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen