Pmp20, Recombinant, Neosartorya Fumigata, aa1-168, His-SUMO-Tag (Putative Peroxiredoxin Pmp20)

Pmp20, Recombinant, Neosartorya Fumigata, aa1-168, His-SUMO-Tag (Putative Peroxiredoxin Pmp20)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374768.20 20 µg - -

3 - 19 Werktage*

511,00 €
374768.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Source:|Recombinant protein corresponding to aa1-168 from neosartorya fumigata pmp20, fused to... mehr
Produktinformationen "Pmp20, Recombinant, Neosartorya Fumigata, aa1-168, His-SUMO-Tag (Putative Peroxiredoxin Pmp20)"
Source:, Recombinant protein corresponding to aa1-168 from neosartorya fumigata pmp20, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.5kD, AA Sequence: MSGLKAGDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVILFALPGAFTPVCSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFSKSIGWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSSAETVLKHL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Prx, TPx, Asp f 3, AFUA_6G02280, Peroxiredoxin Asp f3, Thioredoxin peroxidase
Hersteller: United States Biological
Hersteller-Nr: 374768

Eigenschaften

Konjugat: No
MW: 34,5
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Pmp20, Recombinant, Neosartorya Fumigata, aa1-168, His-SUMO-Tag (Putative Peroxiredoxin Pmp20)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen