PMP2, Recombinant, Equine, aa2-132, His-SUMO-Tag (Myelin P2 Protein)

PMP2, Recombinant, Equine, aa2-132, His-SUMO-Tag (Myelin P2 Protein)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374766.20 20 µg - -

3 - 19 Werktage*

511,00 €
374766.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
May play a role in lipid transport protein in Schwann cells. May bind... mehr
Produktinformationen "PMP2, Recombinant, Equine, aa2-132, His-SUMO-Tag (Myelin P2 Protein)"
May play a role in lipid transport protein in Schwann cells. May bind cholesterol. Source: Recombinant protein corresponding to aa2-132 from equine PMP2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~30.4kD, AA Sequence: SNKFLGTWKLTSSENFDEYMKALGVGLGTRSLGNLAGPTVIISKSGDVITIRTESGFKNTEISFKLGQEFEETTADNRKTKSTVTLAGGKLNQVQKWNGNETTIKRELVDGKMVVECSMASVVCTRIYEQV, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: PMP2, Myelin P2 protein
Hersteller: United States Biological
Hersteller-Nr: 374766

Eigenschaften

Konjugat: No
MW: 30,4
Format: Purified

Datenbank Information

UniProt ID : P0C6G6 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PMP2, Recombinant, Equine, aa2-132, His-SUMO-Tag (Myelin P2 Protein)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen