PLP, Recombinant, Oncorhynchus Mykiss, aa150-218, His-Tag (Myelin Proteolipid Protein)

This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation. Source: Recombinant protein corresponding to aa150-218 from oncorhynchus mykiss PLP, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~11.7kD, AA Sequence: PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.