PLP, Recombinant, Oncorhynchus Mykiss, aa150-218, His-Tag (Myelin Proteolipid Protein)

PLP, Recombinant, Oncorhynchus Mykiss, aa150-218, His-Tag (Myelin Proteolipid Protein)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374752.20 20 µg - -

3 - 19 Werktage*

511,00 €
374752.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
This is the major myelin protein from the central nervous system. It plays an important role in... mehr
Produktinformationen "PLP, Recombinant, Oncorhynchus Mykiss, aa150-218, His-Tag (Myelin Proteolipid Protein)"
This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation. Source: Recombinant protein corresponding to aa150-218 from oncorhynchus mykiss PLP, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~11.7kD, AA Sequence: PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: plp, PLP, DM20, Lipophilin, Myelin proteolipid protein
Hersteller: United States Biological
Hersteller-Nr: 374752

Eigenschaften

Konjugat: No
MW: 11,7
Format: Highly Purified

Datenbank Information

UniProt ID : P79826 | Passende Produkte
Gene ID : GeneID 100136749 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PLP, Recombinant, Oncorhynchus Mykiss, aa150-218, His-Tag (Myelin Proteolipid Protein)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen