PLB, Recombinant, Human, aa1-52, GST-Tag (Cardiac Phospholamban)

PLB, Recombinant, Human, aa1-52, GST-Tag (Cardiac Phospholamban)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374740.20 20 µg - -

3 - 19 Werktage*

416,00 €
374740.100 100 µg - -

3 - 19 Werktage*

637,00 €
 
Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the... mehr
Produktinformationen "PLB, Recombinant, Human, aa1-52, GST-Tag (Cardiac Phospholamban)"
Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca2+. Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation. Source: Recombinant protein corresponding to aa1-52 from human Cardiac Phospholamban, fused to GST-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~33.51kD, AA Sequence: MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: PLN, PLB, Cardiac phospholamban
Hersteller: United States Biological
Hersteller-Nr: 374740

Eigenschaften

Konjugat: No
MW: 33,51
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PLB, Recombinant, Human, aa1-52, GST-Tag (Cardiac Phospholamban)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen