PLA2R1, Recombinant, Human, aa395-530, His-Tag (Secretory Phospholipase A2 Receptor)

PLA2R1, Recombinant, Human, aa395-530, His-Tag (Secretory Phospholipase A2 Receptor)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374731.20 20 µg - -

3 - 19 Werktage*

416,00 €
374731.100 100 µg - -

3 - 19 Werktage*

637,00 €
 
Receptor for secretory phospholipase A2 (sPLA2). Acts as a receptor for phosholipase... mehr
Produktinformationen "PLA2R1, Recombinant, Human, aa395-530, His-Tag (Secretory Phospholipase A2 Receptor)"
Receptor for secretory phospholipase A2 (sPLA2). Acts as a receptor for phosholipase sPLA2-IB/PLA2G1B but not sPLA2-IIA/PLA2G2A. Also able to bind to snake PA2-like toxins. Although its precise function rains unclear, binding of sPLA2 to its receptor participates in both positive and negative regulation of sPLA2 functions as well as clearance of sPLA2. Binding of sPLA2-IB/PLA2G1B induces various effects depending on the cell type, such as activation of the mitogen-activated protein kinase (MAPK) cascade to induce cell proliferation, the production of lipid mediators, selective release of arachidonic acid in bone marrow-derived mast cells. In neutrophils, binding of sPLA2-IB/PLA2G1B can activate p38 MAPK to stimulate elastase release and cell adhesion. May be involved in responses in proinflammatory cytokine productions during endotoxic shock. Also has endocytic properties and rapidly internalizes sPLA2 ligands, which is particularly important for the clearance of Extracellular domain sPLA2s to protect their potent enzymatic activities. The soluble secretory phospholipase A2 receptor form is circulating and acts as a negative regulator of sPLA2 functions by blocking the biological functions of sPLA2-IB/PLA2G1B. Source: Recombinant protein corresponding to aa395-530 from human PLA2R1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.4kD, AA Sequence: EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: PLA2R1, CLEC13C
Hersteller: United States Biological
Hersteller-Nr: 374731

Eigenschaften

Konjugat: No
MW: 17,4
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PLA2R1, Recombinant, Human, aa395-530, His-Tag (Secretory Phospholipase A2 Receptor)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen