PLA2G12A, Recombinant, Human, aa23-185, His-Tag (Group XIIA Secretory Phospholipase A2)

PLA2G12A, Recombinant, Human, aa23-185, His-Tag (Group XIIA Secretory Phospholipase A2)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374721.20 20 µg - -

3 - 19 Werktage*

416,00 €
374721.100 100 µg - -

3 - 19 Werktage*

637,00 €
PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.... mehr
Produktinformationen "PLA2G12A, Recombinant, Human, aa23-185, His-Tag (Group XIIA Secretory Phospholipase A2)"
PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine. Source: Recombinant protein corresponding to aa23-185 from human PLA2G12A, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~20.3kD, AA Sequence: QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: FKSG38, PLA2G12, PLA2G12A, sPLA2-XII, GXII sPLA2, EC=, Group XIIA secretory phospholipase A2, Phosphatidylcholine 2-acylhydrolase 12A
Hersteller: United States Biological
Hersteller-Nr: 374721


Konjugat: No
MW: 20,3
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PLA2G12A, Recombinant, Human, aa23-185, His-Tag (Group XIIA Secretory Phospholipase A2)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen