PI-3, Recombinant, Ascaris Suum, aa21-169, His-SUMO-Tag (Major Pepsin Inhibitor 3)

PI-3, Recombinant, Ascaris Suum, aa21-169, His-SUMO-Tag (Major Pepsin Inhibitor 3)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374702.20 20 µg - -

3 - 19 Werktage*

511,00 €
374702.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
This is an inhibitor of the aspartic protease pepsin.||Source:|Recombinant protein corresponding... mehr
Produktinformationen "PI-3, Recombinant, Ascaris Suum, aa21-169, His-SUMO-Tag (Major Pepsin Inhibitor 3)"
This is an inhibitor of the aspartic protease pepsin. Source: Recombinant protein corresponding to aa21-169 from ascaris suum Major Pepsin Inhibitor 3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.4kD, AA Sequence: QFLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQQENQPPSSGMPHGAVPAGGLSPPPPPSFCTVQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: PI-3, Major pepsin inhibitor 3
Hersteller: United States Biological
Hersteller-Nr: 374702

Eigenschaften

Konjugat: No
MW: 32,4
Format: Highly Purified

Datenbank Information

UniProt ID : P19400 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PI-3, Recombinant, Ascaris Suum, aa21-169, His-SUMO-Tag (Major Pepsin Inhibitor 3)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen