PI-3, Recombinant, Ascaris Suum, aa21-169, His-SUMO-Tag (Major Pepsin Inhibitor 3)

This is an inhibitor of the aspartic protease pepsin. Source: Recombinant protein corresponding to aa21-169 from ascaris suum Major Pepsin Inhibitor 3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.4kD, AA Sequence: QFLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQQENQPPSSGMPHGAVPAGGLSPPPPPSFCTVQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.