PhyA, Recombinant, Aspergillus Niger, aa24-467, His-SUMO-Tag (3-Phytase A)

PhyA, Recombinant, Aspergillus Niger, aa24-467, His-SUMO-Tag (3-Phytase A)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374699.20 20 µg - -

3 - 19 Werktage*

511,00 €
374699.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Catalyzes the hydrolysis of inorganic orthophosphate from phytate.||Source:|Recombinant protein... mehr
Produktinformationen "PhyA, Recombinant, Aspergillus Niger, aa24-467, His-SUMO-Tag (3-Phytase A)"
Catalyzes the hydrolysis of inorganic orthophosphate from phytate. Source: Recombinant protein corresponding to aa24-467 from aspergillus niger phyA, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~64.8kD, AA Sequence: ASRNQSSCDTVDQGYQCFSETSHLWGQYAPFFSLANESVISPEVPAGCRVTFAQVLSRHGARYPTDSKGKKYSALIEEIQQNATTFDGKYAFLKTYNYSLGADDLTPFGEQELVNSGIKFYQRYESLTRNIVPFIRSSGSSRVIASGKKFIEGFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSELADTVEANFTATFVPSIRQRLENDLSGVTLTDTEVTYLMDMCSFDTISTSTVDTKLSPFCDLFTHDEWINYDYLQSLKKYYGHGAGNPLGPTQGVGYANELIARLTHSPVHDDTSSNHTLDSSPATFPLNSTLYADFSHDNGIISILFALGLYNGTKPLSTTTVENITQTDGFSSAWTVPFASRLYVEMMQCQAEQEPLVRVLVNDRVVPLHGCPVDALGRCTRDSFVRGLSFARSGGDWAECFA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: phyA, EC=3.1.3.8, 3 phytase A, 3-phytase A, Myo-inositol-hexaphosphate 3-phosphohydrolase A, Myo-inositol hexakisphosphate phosphohydrolase A
Hersteller: United States Biological
Hersteller-Nr: 374699

Eigenschaften

Konjugat: No
MW: 64,8
Format: Highly Purified

Datenbank Information

UniProt ID : P34752 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PhyA, Recombinant, Aspergillus Niger, aa24-467, His-SUMO-Tag (3-Phytase A)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen