Phospholipase C, Recombinant, Staphylococcus Aureus, aa35-330, His-tag (hlb)

Phospholipase C, Recombinant, Staphylococcus Aureus, aa35-330, His-tag (hlb)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
406020.20 20 µg - -

3 - 19 Werktage*

497,00 €
406020.100 100 µg - -

3 - 19 Werktage*

827,00 €
 
Bacterial hemolysins are exotoxins that attack blood cell membranes and cause cell rupture.... mehr
Produktinformationen "Phospholipase C, Recombinant, Staphylococcus Aureus, aa35-330, His-tag (hlb)"
Bacterial hemolysins are exotoxins that attack blood cell membranes and cause cell rupture. Beta-hemolysin is a phospholipase C with specific activity toward sphingomyelins. Has a high specificity for sphingomyelin, hydrolyzes lysophosphatidylcholine at a much lower rate, but has no activity towards phosphatidylcholine, phosphatidylethanolamine, or phosphatidylserine. Source: Recombinant protein corresponding to aa35-330 from Staphylococcus Aureus Phospholipase C, fused to His-tag at N-terminal, expressed in Yeast. Molecular Weight: ~35.7kD, AA Sequence: ESKKDDTDLKLVSHNVYMLSTVLYPNWGQYKRADLIGQSSYIKNNDVVIFNEAFDNGASDKLLSNVKKEYPYQTPVLGRSQSGWDKTEGSYSSTVAEDGGVAIVSKYPIKEKIQHVFKSGCGFDNDSNKGFVYTKIEKNGKNVHVIGTHTQSEDSRCGAGHDRKIRAEQMKEISDFVKKKNIPKDETVYIGGDLNVNKGTPEFKDMLKNLNVNDVLYAGHNSTWDPQSNSIAKYNYPNGKPEHLDYIFTDKDHKQPKQLVNEVVTEKPKPWDVYAFPYYYVYNDFSDHYPIKAYSK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: hlb, plc, SMase, EC=3.1.4.3, Beta-toxin, Beta-hemolysin, Phospholipase C, Sphingomyelinase
Hersteller: United States Biological
Hersteller-Nr: 406020

Eigenschaften

Konjugat: No
MW: 35,7
Format: Purified

Datenbank Information

UniProt ID : P09978 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Phospholipase C, Recombinant, Staphylococcus Aureus, aa35-330, His-tag (hlb)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen