Phosphocarrier Protein HPr, Recombinant, Bacillus Subtilis, aa2-88, His-SUMO-Tag (PtsH)

Phosphocarrier Protein HPr, Recombinant, Bacillus Subtilis, aa2-88, His-SUMO-Tag (PtsH)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374693.20 20 µg - -

3 - 19 Werktage*

511,00 €
374693.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar... mehr
Produktinformationen "Phosphocarrier Protein HPr, Recombinant, Bacillus Subtilis, aa2-88, His-SUMO-Tag (PtsH)"
General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS). This major carbohydrate active-transport system catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein HPr by enzyme I. Phospho-HPr then transfers it to the permease (enzymes II/III). P-Ser-HPr interacts with the catabolite control protein A (CcpA), forming a complex that binds to DNA at the catabolite response elements cre, operator sites preceding a large number of catabolite-regulated genes. Thus, P-Ser-HPr is a corepressor in carbon catabolite repression (CCR), a mechanism that allows bacteria to coordinate and optimize the utilization of available carbon sources. P-Ser-HPr also plays a role in inducer exclusion, in which it probably interacts with several non-PTS permeases and inhibits their transport activity. Source: Recombinant protein corresponding to aa2-88 from bacillus subtilis ptsH, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~25.1kD, AA Sequence: AQKTFKVTADSGIHARPATVLVQTASKYDADVNLEYNGKTVNLKSIMGVMSLGIAKGAEITISASGADENDALNALEETMKSEGLGE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: ptsH, BSU13900, Phosphocarrier protein HPr, Histidine-containing protein
Hersteller: United States Biological
Hersteller-Nr: 374693

Eigenschaften

Konjugat: No
MW: 25,1
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Phosphocarrier Protein HPr, Recombinant, Bacillus Subtilis, aa2-88, His-SUMO-Tag (PtsH)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen