PHLPI, Recombinant, Phleum pratense, aa24-263, His-SUMO-Tag (Pollen allergen Phl p 1)

PHLPI, Recombinant, Phleum pratense, aa24-263, His-SUMO-Tag (Pollen allergen Phl p 1)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374688.20 20 µg - -

3 - 19 Werktage*

511,00 €
374688.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Source:|Recombinant protein corresponding to aa24-263 from phleum pratense PHLPI, fused to... mehr
Produktinformationen "PHLPI, Recombinant, Phleum pratense, aa24-263, His-SUMO-Tag (Pollen allergen Phl p 1)"
Source:, Recombinant protein corresponding to aa24-263 from phleum pratense PHLPI, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.2kD, AA Sequence: IPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYESK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: PHLPI, Phl p 1, Allergen Phl p I, Pollen allergen Phl p 1
Hersteller: United States Biological
Hersteller-Nr: 374688

Eigenschaften

Konjugat: No
MW: 42,2
Format: Highly Purified

Datenbank Information

UniProt ID : P43213 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PHLPI, Recombinant, Phleum pratense, aa24-263, His-SUMO-Tag (Pollen allergen Phl p 1)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen