Ovomucoid, Recombinant, Coturnix Delegorguei, aa1-52, His-SUMO-Tag, Myc-Tag

Source:, Recombinant protein corresponding to aa1-52 from Coturnix delegorguei Ovomucoid, fused to His-SUMO-Tag at N-terminal and fused to Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~25.7kD, AA Sequence: SVDCSEYPKPACPKDYRPVCGSDNKTYGNKCNFCNAVVESNGTLTLNRFGKC, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.